2.20 Rating by ClearWebStats
bayareapetsvet.com is 6 years 1 month 2 weeks old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, bayareapetsvet.com is SAFE to browse.
Get Custom Widget

Traffic Report of Bayareapetsvet

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
67
Siteadvisor Rating
View bayareapetsvet.com site advisor rating Not Applicable

Where is bayareapetsvet.com server located?

Hosted IP Address:

37.60.244.250 View other site hosted with bayareapetsvet.com

Hosted Country:

bayareapetsvet.com hosted country US bayareapetsvet.com hosted country

Location Latitude:

41.85

Location Longitude:

-87.65

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View bayareapetsvet.com HTML resources

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 6
H3 Headings: 3 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 14
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 37.60.244.250)

Ministry Updates – for Africa International Christian Mission

bayareapetsvet.com favicon - africa-christian-mission-updates.com

View bayareapetsvet.com Pagerank   bayareapetsvet.com alexa rank Not Applicable   bayareapetsvet.com website value $ 8.95

Fairway Equipment

bayareapetsvet.com favicon - fairwayequipment.com

Shop powered by PrestaShop

View bayareapetsvet.com Pagerank   bayareapetsvet.com alexa rank Not Applicable   bayareapetsvet.com website value $ 8.95

Home page

bayareapetsvet.com favicon - fairwaymagento.com

Default Description

View bayareapetsvet.com Pagerank   bayareapetsvet.com alexa rank Not Applicable   bayareapetsvet.com website value $ 8.95

COMING SOON

bayareapetsvet.com favicon - pacificlinkva.com

View bayareapetsvet.com Pagerank   bayareapetsvet.com alexa rank Not Applicable   bayareapetsvet.com website value $ 8.95

SiteGround System Page Coming Soon

bayareapetsvet.com favicon - bryanwilksharvardmasterdegree.com

View bayareapetsvet.com Pagerank   bayareapetsvet.com alexa rank Not Applicable   bayareapetsvet.com website value $ 8.95

HTTP Header Analysis

Http-Version: 1.1
Status-Code: 200
Status: 200 OK
Server: nginx
Date: Tue, 03 Apr 2018 04:50:54 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate
Pragma: no-cache
Host-Header: 192fc2e7e50945beb8231a492d6a8024
X-Proxy-Cache: MISS

Domain Information for bayareapetsvet.com

Domain Registrar: TUCOWS DOMAINS INC. bayareapetsvet.com registrar info
Registration Date: 2018-03-26 6 years 1 month 2 weeks ago
Last Modified: 2018-03-26 6 years 1 month 2 weeks ago

Domain Nameserver Information

Host IP Address Country
ns1.us63.siteground.us bayareapetsvet.com name server information 75.2.77.104 bayareapetsvet.com server is located in United States United States
ns2.us63.siteground.us bayareapetsvet.com name server information 99.83.229.113 bayareapetsvet.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
bayareapetsvet.com A 14400 IP:37.60.244.250
bayareapetsvet.com NS 86400 Target:ns2.us63.siteground.us
bayareapetsvet.com NS 86400 Target:ns1.us63.siteground.us
bayareapetsvet.com SOA 86400 MNAME:ns1.us63.siteground.us
RNAME:dnsadmin.us63.siteground.us
Serial:2018032606
Refresh:3600
Retry:900
Expire:1209600
bayareapetsvet.com MX 3600 Priority:20
Target:mx20.mailspamprotection.com
bayareapetsvet.com MX 3600 Priority:10
Target:mx10.mailspamprotection.com
bayareapetsvet.com MX 3600 Priority:30
Target:mx30.mailspamprotection.com
bayareapetsvet.com TXT 14400 TXT:v=spf1 +a +mx +a:ns1.us63.siteground.us
include:_spf.mailspamprotection.com ~all

Similarly Ranked Websites to Bayareapetsvet

Google

bayareapetsvet.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View bayareapetsvet.com Pagerank   Alexa rank for bayareapetsvet.com 1   website value of bayareapetsvet.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

bayareapetsvet.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View bayareapetsvet.com Pagerank   Alexa rank for bayareapetsvet.com 1   website value of bayareapetsvet.com $ 8,833,062,960.00

Gmail

bayareapetsvet.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View bayareapetsvet.com Pagerank   Alexa rank for bayareapetsvet.com 1   website value of bayareapetsvet.com $ 8,833,062,960.00

Android Apps on Google Play

bayareapetsvet.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View bayareapetsvet.com Pagerank   Alexa rank for bayareapetsvet.com 1   website value of bayareapetsvet.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

bayareapetsvet.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View bayareapetsvet.com Pagerank   Alexa rank for bayareapetsvet.com 1   website value of bayareapetsvet.com $ 8,833,062,960.00

Full WHOIS Lookup for bayareapetsvet.com

Domain Name: BAYAREAPETSVET.COM
Registry Domain ID: 2243751675_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.tucows.com
Registrar URL: http://www.tucowsdomains.com
Updated Date: 2018-03-26T05:59:32Z
Creation Date: 2018-03-26T05:59:31Z
Registry Expiry Date: 2019-03-26T05:59:31Z
Registrar: Tucows Domains Inc.
Registrar IANA ID: 69
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Name Server: NS1.US63.SITEGROUND.US
Name Server: NS2.US63.SITEGROUND.US
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2018-04-03T04:50:44Z